Total number of results for Homarus americanus are 121
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00101 |
QLNFSPGW
|
8 | Homarus americanus | AKH/HRTH/RPCH | Red pigment-concentrating hormone | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00411 |
AGGAYSFGL
|
9 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00412 |
AGPYAFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00413 |
AGPYSFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 18088365#Cape SS, Rehm KJ, Ma M, Marder E, Li L#Mass spectral comparison of the neuropeptide complement of the stomatogastric ganglion and brain in the adult and embryonic lobster, Homarus americanus#J Neurochem 2008 May;105(3):690-702 | |
| NP00414 |
ASPYAFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00415 |
EPYAFGL
|
7 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00416 |
ERAYSFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00417 |
PRDYAFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP00418 |
PRNYAFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP00419 |
RQYAFGL
|
7 | Homarus americanus | Allatostatin | Allatostatin A | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP00420 |
SGPYAFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00421 |
SGPYSFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00422 |
SPYAFGL
|
7 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00423 |
SQYTFGL
|
7 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00424 |
TPSYAFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00425 |
VGPYAFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00426 |
VPRYAFG
|
7 | Homarus americanus | Allatostatin | Allatostatin A | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00427 |
GNWNKFQGSW
|
10 | Homarus americanus | Allatostatin | Allatostatin B | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00428 |
NWNKFQGSW
|
9 | Homarus americanus | Allatostatin | Allatostatin B | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00429 |
STNWSSLRSAW
|
11 | Homarus americanus | Allatostatin | Allatostatin B | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP00430 |
TNWNKFQGSW
|
10 | Homarus americanus | Allatostatin | Allatostatin B | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP00431 |
QIRYHQCYFNPISCF
|
15 | Homarus americanus | Allatostatin | Allatostatin C | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00653 |
PLGFLSQDHS
|
10 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00654 |
PLGFLSQDHSV
|
11 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00655 |
PLGFLSQDHSVN
|
12 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00656 |
RSVEGASRMEKL
|
12 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00657 |
RSVEGASRMEKLL
|
13 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00658 |
RSVEGASRMEKLLS
|
14 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00659 |
RSVEGASRMEKLLSS
|
15 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00660 |
RSVEGASRMEKLLSSS
|
16 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00661 |
RSVEGASRMEKLLSSSN
|
17 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00662 |
RSVEGASRMEKLLT
|
14 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00663 |
RSVEGVSRME
|
10 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00664 |
RSVEGVSRMEKLL
|
13 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00665 |
RSVEGVSRMEKLLS
|
14 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00666 |
RSVEGVSRMEKLLSSISPSSTPLGFLSQDHSVN
|
33 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00667 |
RSVEGVSRMEKLLT
|
14 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00688 |
RSVEGASRMEKLLSSSNSPSSTPLGFLSQDHSVN
|
34 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide A(Potential) | ||
| NP00689 |
QVFDQACKGVYDRNLFKKLDRVCEDCYNLYRKPFVATTCRENCYSNWVFRQCLDDLLLSDVIDEYVSNVQMV
|
72 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone A | 2169734#Chang E.S., Prestwich G.D., Bruce M.J.; #Amino acid sequence of a peptide with both molt-inhibiting and hyperglycemic activities in the lobster, Homarus americanus.; #Biochem. Biophys. Res. Commun. 171:818-826(1990). | |
| NP00690 |
RSVEGVSRMEKLLSSSISPSSTPLGFLSQDHSVN
|
34 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide B | 1788131#Tensen C.P., Verhoeven A.H.M., Gaus G., Janssen K.P.C., Keller R., van Herp F.; #Isolation and amino acid sequence of crustacean hyperglycemic hormone precursor-related peptides.; #Peptides 12:673-681(1991). | |
| NP00691 |
QVFDQACKGVYDRNLFKKLNRVCEDCYNLYRKPFIVTTCRENCYSNRVFRQCLDDLLLSDVIDEYVSNVQMV
|
72 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone B | ||
| NP00692 |
ASAWFTNDECPGVMGNRDLYEKVAWVCNDCANIFRNNDVGVMCKKDCFHTMDFLWCVYATERHGEIDQFRKWVSILRA
|
78 | Homarus americanus | Arthropod CHH/MIH/GIH/VIH hormone | Gonad-inhibiting hormone | 1791922#Soyez D., Le Caer J.-P., Noel P.Y., Rossier J.; #Primary structure of two isoforms of the vitellogenesis inhibiting hormone from the lobster Homarus americanus.; #Neuropeptides 20:25-32(1991). | |
| NP00738 |
NSELINSILGLPKVMNDA
|
18 | Homarus americanus | Arthropod PDH | β-PDH | 16214114#Fu Q, Goy MF, Li L#Identification of neuropeptides from the decapod crustacean sinus glands using nanoscale liquid chromatography tandem mass spectrometry#Biochem Biophys Res Commun 2005 Nov 25;337(3):765-78 | |
| NP00739 |
NSELINSLLGISRLMNEA
|
18 | Homarus americanus | Arthropod PDH | β-PDH | 16214114#Fu Q, Goy MF, Li L#Identification of neuropeptides from the decapod crustacean sinus glands using nanoscale liquid chromatography tandem mass spectrometry#Biochem Biophys Res Commun 2005 Nov 25;337(3):765-78 | |
| NP00859 |
GLDLGLGRGFSGSQAAKHLMGLAAANFAGGP
|
31 | Homarus americanus | Calcitonin-like peptide | Calcitonin-like diuretic hormone | 20008368#Christie AE, Stevens JS, Bowers MR, Chapline MC, Jensen DA, Schegg KM, Goldwaser J, Kwiatkowski MA, Pleasant TK Jr, Shoenfeld L, Tempest LK, Williams CR, Wiwatpanit T, Smith CM, Beale KM, Towle DW, Schooley DA, Dickinson PS#Identification of a calcitonin-like diuretic hormone that functions as an intrinsic modulator of the American lobster, Homarus americanus, cardiac neuromuscular system#J Exp Biol 2010 Jan 1;213(1):118-27 | |
| NP00889 |
PFCNAFTGC
|
9 | Homarus americanus | CCAP | Crustacean cardioactive peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP01032 |
QTFQYSRGWTN
|
11 | Homarus americanus | Corazonin | Corazonin | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP01476 |
APQRNFLRF
|
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-like peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP01477 |
DRNFLRF
|
7 | Homarus americanus | FMRFamide related peptide | FMRFamide-like peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP01478 |
NFLRF
|
5 | Homarus americanus | FMRFamide related peptide | FMRFamide-like peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP01479 |
RNFLRF
|
6 | Homarus americanus | FMRFamide related peptide | FMRFamide-like peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP01480 |
SKNFLRF
|
7 | Homarus americanus | FMRFamide related peptide | FMRFamide-like peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP01481 |
APSKNFLRF
|
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP01482 |
DQNRNFLRF
|
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP01483 |
DRNYLRF
|
7 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP01484 |
DTSTPALRLRF
|
11 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP01485 |
FEPSLRLRF
|
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP01486 |
FSHDRNFLRF
|
10 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP01487 |
GAHKNYLRF
|
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP01488 |
GDRNFLRF
|
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP01489 |
GGGEYDDYGHLRF
|
13 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP01490 |
GGRNFLRF
|
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP01491 |
GNRNFLRF
|
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP01492 |
GPPSLRLRF
|
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP01493 |
GPRNFLRF
|
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP01494 |
GYPSRNYLRF
|
10 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP01495 |
GYSDRNYLRF
|
10 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP01496 |
HDRNFLRF
|
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP01497 |
QLDRNFLRF
|
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP01498 |
QPRNFLRF
|
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP01499 |
SDRNYLRF
|
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP01500 |
SGRNFLRF
|
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP01501 |
SMPSLRLRF
|
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP01502 |
SPKNFLRF
|
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP01503 |
YSDRNYLRF
|
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP01504 |
NRNFLRF
|
7 | Homarus americanus | FMRFamide related peptide | RFamide | 18088365#Cape SS, Rehm KJ, Ma M, Marder E, Li L#Mass spectral comparison of the neuropeptide complement of the stomatogastric ganglion and brain in the adult and embryonic lobster, Homarus americanus#J Neurochem 2008 May;105(3):690-702 | |
| NP01505 |
RKPPFNGSIF
|
10 | Homarus americanus | FMRFamide related peptide | SIFamide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP01506 |
VYRKPPFNGSIF
|
12 | Homarus americanus | FMRFamide related peptide | SIFamide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP01758 |
SDRNFLRF
|
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-like neuropeptide 3 | 3429714#Trimmer B.A., Kobierski L.A., Kravitz E.A.; #Purification and characterization of FMRFamidelike immunoreactive substances from the lobster nervous system: isolation and sequence analysis of two closely related peptides.; #J. Comp. Neurol. 266:16-26(1987). | |
| NP01759 |
TNRNFLRF
|
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-like neuropeptide 4 | 3429714#Trimmer B.A., Kobierski L.A., Kravitz E.A.; #Purification and characterization of FMRFamidelike immunoreactive substances from the lobster nervous system: isolation and sequence analysis of two closely related peptides.; #J. Comp. Neurol. 266:16-26(1987). | |
| NP03064 |
QDLDHVFLRF
|
10 | Homarus americanus | Myosuppressin | Myosuppressin | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP03387 |
DIGDLLEGKD
|
10 | Homarus americanus | NA | CCAP precursor-related peptides | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP03388 |
AVLLPKKTEKK
|
11 | Homarus americanus | NA | NA | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP03389 |
DLPKVDTALK
|
10 | Homarus americanus | NA | NA | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP03390 |
EVEEPEAPAPPAK
|
13 | Homarus americanus | NA | NA | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP03391 |
GPSGGFNGALAR
|
12 | Homarus americanus | NA | NA | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP03392 |
KPKTEKK
|
7 | Homarus americanus | NA | NA | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP03393 |
LRVAPEEHPVLL
|
12 | Homarus americanus | NA | NA | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP03394 |
HI/LASLYKPR
|
9 | Homarus americanus | NA | NA | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP03395 |
RYLPT
|
5 | Homarus americanus | NA | Proctolin | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP03396 |
HIGSLYR
|
7 | Homarus americanus | NA | YRamide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP03816 |
PSLRLRF
|
7 | Homarus americanus | NPY | Short neuropeptide F | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP04281 |
SSEDMDRL/IGFG
|
11 | Homarus americanus | Orcokinin | Hoa-Orcokinins | 16214114#Fu Q, Goy MF, Li L#Identification of neuropeptides from the decapod crustacean sinus glands using nanoscale liquid chromatography tandem mass spectrometry#Biochem Biophys Res Commun 2005 Nov 25;337(3):765-78 | |
| NP04282 |
SSEDMDRL/IGFGFN
|
13 | Homarus americanus | Orcokinin | Hoa-Orcokinins | 16214114#Fu Q, Goy MF, Li L#Identification of neuropeptides from the decapod crustacean sinus glands using nanoscale liquid chromatography tandem mass spectrometry#Biochem Biophys Res Commun 2005 Nov 25;337(3):765-78 | |
| NP04283 |
FDAFTTGFGHN
|
11 | Homarus americanus | Orcokinin | Orcokinin | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP04284 |
NFDEIDRSGF
|
10 | Homarus americanus | Orcokinin | Orcokinin | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP04285 |
NFDEIDRSGFA
|
11 | Homarus americanus | Orcokinin | Orcokinin | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP04286 |
NFDEIDRSGFG
|
11 | Homarus americanus | Orcokinin | Orcokinin | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP04287 |
NFDEIDRSGFGF
|
12 | Homarus americanus | Orcokinin | Orcokinin | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP04288 |
NFDEIDRSGFGFA
|
13 | Homarus americanus | Orcokinin | Orcokinin | 16214114#Fu Q, Goy MF, Li L#Identification of neuropeptides from the decapod crustacean sinus glands using nanoscale liquid chromatography tandem mass spectrometry#Biochem Biophys Res Commun 2005 Nov 25;337(3):765-78 | |
| NP04289 |
NFDEIDRSGFGFH
|
13 | Homarus americanus | Orcokinin | Orcokinin | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP04290 |
NFDEIDRSGFGFN
|
13 | Homarus americanus | Orcokinin | Orcokinin | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP04291 |
NFDEIDRSGFGFV
|
13 | Homarus americanus | Orcokinin | Orcokinin | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP04292 |
NFDEIDRSSFA
|
11 | Homarus americanus | Orcokinin | Orcokinin | 16214114#Fu Q, Goy MF, Li L#Identification of neuropeptides from the decapod crustacean sinus glands using nanoscale liquid chromatography tandem mass spectrometry#Biochem Biophys Res Commun 2005 Nov 25;337(3):765-78 | |
| NP04293 |
NFDEIDRSSFG
|
11 | Homarus americanus | Orcokinin | Orcokinin | 16214114#Fu Q, Goy MF, Li L#Identification of neuropeptides from the decapod crustacean sinus glands using nanoscale liquid chromatography tandem mass spectrometry#Biochem Biophys Res Commun 2005 Nov 25;337(3):765-78 | |
| NP04294 |
NFDEIDRSSFGFN
|
13 | Homarus americanus | Orcokinin | Orcokinin | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP04295 |
NFDEIDRSSFGFV
|
13 | Homarus americanus | Orcokinin | Orcokinin | 16214114#Fu Q, Goy MF, Li L#Identification of neuropeptides from the decapod crustacean sinus glands using nanoscale liquid chromatography tandem mass spectrometry#Biochem Biophys Res Commun 2005 Nov 25;337(3):765-78 | |
| NP04296 |
NFDELDRSGFGFH
|
13 | Homarus americanus | Orcokinin | Orcokinin | 16214114#Fu Q, Goy MF, Li L#Identification of neuropeptides from the decapod crustacean sinus glands using nanoscale liquid chromatography tandem mass spectrometry#Biochem Biophys Res Commun 2005 Nov 25;337(3):765-78 | |
| NP04297 |
SSEDMDRLGFA
|
11 | Homarus americanus | Orcokinin | Orcokinin | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP04298 |
SSEDMDRLGFG
|
11 | Homarus americanus | Orcokinin | Orcokinin | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP04299 |
SSEDMDRLGFGFN
|
13 | Homarus americanus | Orcokinin | Orcokinin | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP04300 |
VYGPRDIANLY
|
11 | Homarus americanus | Orcokinin | Orcokinin | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP04301 |
FDAFTTGF
|
8 | Homarus americanus | Orcokinin | Orcomyotropin | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP04302 |
FDAFTTGFGHS
|
11 | Homarus americanus | Orcokinin | Orcomyotropin | 16214114#Fu Q, Goy MF, Li L#Identification of neuropeptides from the decapod crustacean sinus glands using nanoscale liquid chromatography tandem mass spectrometry#Biochem Biophys Res Commun 2005 Nov 25;337(3):765-78 | |
| NP04969 |
FSPRL
|
5 | Homarus americanus | Pyrokinin | Pyrokinin | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP05528 |
TPSGFLGMR
|
9 | Homarus americanus | Tachykinin | Tachykinin-related peptide | 18706463#Christie AE, Cashman CR, Stevens JS, Smith CM, Beale KM, Stemmler EA, Greenwood SJ, Towle DW, Dickinson PS#Identification and cardiotropic actions of brain/gut-derived tachykinin-related peptides (TRPs) from the American lobster Homarus americanus#Peptides 2008 Nov;29(11):1909-18 | |
| NP05573 |
APSGFLGMR
|
9 | Homarus americanus | Tachykinin | Tachykinin | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP05574 |
APSGFLGMR
|
9 | Homarus americanus | Tachykinin | Tachykinin | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP05575 |
APSGFLGMRG
|
10 | Homarus americanus | Tachykinin | Tachykinin | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP05576 |
SGFLGMR
|
7 | Homarus americanus | Tachykinin | Tachykinin | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP05577 |
PSGFLGMR
|
8 | Homarus americanus | Tachykinin | Tachykinin-related peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 |